Sequence 1: | NP_732637.1 | Gene: | bap / 42537 | FlyBaseID: | FBgn0004862 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009298848.1 | Gene: | hoxc11b / 570925 | ZFINID: | ZDB-GENE-000822-3 | Length: | 306 | Species: | Danio rerio |
Alignment Length: | 267 | Identity: | 67/267 - (25%) |
---|---|---|---|
Similarity: | 99/267 - (37%) | Gaps: | 85/267 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 PETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSAR--QPSNYLQY 97
Fly 98 YA------------------AAMDNN---NHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMR 141
Fly 142 R---CTSNDSD------C----DSPPPLSSSPSESPL--SHDG---------------------- 169
Fly 170 ------SGLS---RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQN 225
Fly 226 RRYKTKR 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bap | NP_732637.1 | Homeobox | 178..231 | CDD:278475 | 23/52 (44%) |
hoxc11b | XP_009298848.1 | DUF3528 | 41..180 | CDD:288866 | 32/154 (21%) |
Homeobox | 237..290 | CDD:278475 | 23/52 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |