DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and hoxc11b

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_009298848.1 Gene:hoxc11b / 570925 ZFINID:ZDB-GENE-000822-3 Length:306 Species:Danio rerio


Alignment Length:267 Identity:67/267 - (25%)
Similarity:99/267 - (37%) Gaps:85/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSAR--QPSNYLQY 97
            ||...:||.  .|:.:..:.:.....:.::.|.:  |||       |.|:.||.:  ...||...
Zfish    41 PEFSTVSSF--LPQAQSRQITYSYSTNFTQVPQV--RDL-------PFELNPSGKWHHRGNYSSC 94

  Fly    98 YA------------------AAMDNN---NHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMR 141
            ||                  ..|.|.   ||||.....::.....|     :..|.|...|....
Zfish    95 YAEEDLVHRDCLPPSATMTEMLMKNENVYNHHHYHPAINHPGTGFY-----SSIGKTNVLPQSFD 154

  Fly   142 R---CTSNDSD------C----DSPPPLSSSPSESPL--SHDG---------------------- 169
            |   |..:.:|      |    .|..|.|:|...|.|  :.||                      
Zfish   155 RFLDCAQSGADGGSEGNCLQKGSSGKPESASQVSSVLRSTADGEKELECEKNTTSGSFETSSGTK 219

  Fly   170 ------SGLS---RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQN 225
                  ||.|   |.::.|..::..|:.||||.|....|::..:|.::::.|.||:.||||||||
Zfish   220 NDNQTKSGHSTTPRMRKKRCPYTKFQIRELEREFFFNVYINKEKRLQLSRILNLTDRQVKIWFQN 284

  Fly   226 RRYKTKR 232
            ||.|.|:
Zfish   285 RRMKEKK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 23/52 (44%)
hoxc11bXP_009298848.1 DUF3528 41..180 CDD:288866 32/154 (21%)
Homeobox 237..290 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.