DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP012428

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_001688571.1 Gene:AgaP_AGAP012428 / 5668381 VectorBaseID:AGAP012428 Length:279 Species:Anopheles gambiae


Alignment Length:243 Identity:77/243 - (31%)
Similarity:109/243 - (44%) Gaps:57/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LSSSPSESPLSHDGSGLSRKKR-SRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQV 219
            ||||          ||||:|:| :|.||:..|:..||:.|.:|:|||..:|.|:|..|.|::|||
Mosquito    15 LSSS----------SGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLGLSDTQV 69

  Fly   220 KIWFQNRRYKTKRKQI----QQHEAALLGASKRV---PVQVLVREDGSTTYAHMAAPGAGHGLDP 277
            |.|:||||.|.||:..    ...||....|.:|:   |..:     |:..|   ..|....|...
Mosquito    70 KTWYQNRRTKWKRQTAVGLELLAEAGNYAAFQRLYGGPPYI-----GAWPY---PTPSGPPGTSQ 126

  Fly   278 ALIN-IYRHQLQLAYGGLPLPQMQMPFPY-FYPQHKVPQ------------PIPPPTQSSSFVTA 328
            :.:: .|||....|       .:|.|.|| .||  .||.            |.|..:.|||..|.
Mosquito   127 SAVDAYYRHAAAAA-------ALQKPLPYRMYP--GVPTIGTLNPISGPSGPFPHLSASSSLSTL 182

  Fly   329 SS---ASSSPVPIPIPGAVRPQRTPCPSPNGQMMSVESGAESVHSAAE 373
            ||   |:....|   .|::..|  |..:|:|....:..|..||.:.::
Mosquito   183 SSYYQANCGQQP---AGSLLQQ--PHQTPSGGSNQLRDGETSVGAGSQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
AgaP_AGAP012428XP_001688571.1 Homeobox 29..81 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.