DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP004648

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_001688961.2 Gene:AgaP_AGAP004648 / 5667717 VectorBaseID:AGAP004648 Length:789 Species:Anopheles gambiae


Alignment Length:235 Identity:63/235 - (26%)
Similarity:92/235 - (39%) Gaps:84/235 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQ 234
            :||.|  |.|.|:::.|:.|||:.|...:||..|.|.|:|.||.|||.|||:||||||.|.||:.
Mosquito   181 NGLPR--RLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQT 243

  Fly   235 IQ--------------QHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRH 285
            :.              :|| .|:|         :|.:..|                         
Mosquito   244 LSKTDDDESGKDDLKGEHE-QLIG---------IVSDSNS------------------------- 273

  Fly   286 QLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFV---TASSASSSPVPIPIPGAVRPQ 347
              :.:..|..||.               ..||..|.||..:   |.::..||||       :.|.
Mosquito   274 --KKSCQGCELPS---------------DDIPDSTSSSRGMNNNTPNTGKSSPV-------MTPN 314

  Fly   348 RT-PCPSPNGQMMSVESG-----AESVHSAAEDVDENVEI 381
            .| ...:|.|...|...|     |:|..::.:.:||..::
Mosquito   315 STIDISTPTGGGGSTSGGTNAVSADSSVASTDSIDEEDDV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 28/52 (54%)
AgaP_AGAP004648XP_001688961.2 Homeobox 188..240 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.