powered by:
Protein Alignment bap and AgaP_AGAP005041
DIOPT Version :9
Sequence 1: | NP_732637.1 |
Gene: | bap / 42537 |
FlyBaseID: | FBgn0004862 |
Length: | 382 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001688472.1 |
Gene: | AgaP_AGAP005041 / 5667286 |
VectorBaseID: | AGAP005041 |
Length: | 263 |
Species: | Anopheles gambiae |
Alignment Length: | 61 |
Identity: | 33/61 - (54%) |
Similarity: | 45/61 - (73%) |
Gaps: | 0/61 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 174 RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQ 234
:.:|.|.||:..|:.|||::|...:|||.|:|.|:|.:|.|:||||||||||||.|.||.:
Mosquito 11 KARRPRTAFTSQQLLELEKQFKVSKYLSRPKRYEVANNLLLSETQVKIWFQNRRMKWKRSR 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D858478at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.