DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP000858

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_001688966.2 Gene:AgaP_AGAP000858 / 5666764 VectorBaseID:AGAP000858 Length:692 Species:Anopheles gambiae


Alignment Length:251 Identity:58/251 - (23%)
Similarity:87/251 - (34%) Gaps:81/251 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQ 234
            ||:...:|..|..:..|:.||||.|.:..|.....|.|:|..:.|||.:|::||||||.|.::.:
Mosquito   102 SGILLVRRDEAKAAPLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKSE 166

  Fly   235 I---------------QQHEAALLGASKRVP--------------VQVLVREDGSTTYAHMA--- 267
            .               |...:...||:...|              |.:||....:|..:.|.   
Mosquito   167 KTTGGGPGGGDPDQDGQDVLSTSTGAATTCPRADGTGDTGLLGDEVGLLVDAADATGSSRMLNDD 231

  Fly   268 --APGAG------HGLDPALINIYRHQLQLAYGGL-------------------PLPQMQMPFPY 305
              ..|.|      ||:...|.:.:..|...:.|||                   .|.|.|.    
Mosquito   232 EDDDGLGLSDEVLHGMGGGLKSQHHSQAVASLGGLGKSLNDAMSGEQAGHHLHHHLQQQQQ---- 292

  Fly   306 FYPQHKV-----------PQPIPPPTQSSSFVTASSASSSPVPIPI------PGAV 344
             :.||.|           ...:.|.:.|||.:|....|...:.:.:      ||.|
Mosquito   293 -HHQHHVGPGARTSLLDTVDVVLPGSSSSSGLTFDGGSLHGMTLGLADDPTGPGVV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 22/52 (42%)
AgaP_AGAP000858XP_001688966.2 Homeobox 116..163 CDD:278475 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.