DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and nkx3-1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001373254.1 Gene:nkx3-1 / 555375 ZFINID:ZDB-GENE-081104-238 Length:185 Species:Danio rerio


Alignment Length:117 Identity:58/117 - (49%)
Similarity:77/117 - (65%) Gaps:12/117 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 RCTSNDSDCDSPPPLSSSPSESPLSHD--GSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPE 204
            |..|.|...||.....:|..::..|.:  |.| .:||||||||:|.||.|||::|::|||||.||
Zfish    35 RDDSTDRQTDSADTCRTSEGKTVSSTEMTGGG-GKKKRSRAAFTHLQVLELEKKFSRQRYLSAPE 98

  Fly   205 RSEMAKSLRLTETQVKIWFQNRRYKTKRKQI---------QQHEAALLGASK 247
            |:.:|.:|.|||||||||||||||||||:|:         |:..||.:.|::
Zfish    99 RTHLASALHLTETQVKIWFQNRRYKTKRRQLTTEHSKDYFQKSNAAAMAATE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 38/52 (73%)
nkx3-1NP_001373254.1 COG5576 15..>136 CDD:227863 54/101 (53%)
Homeobox 72..126 CDD:395001 39/53 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003099
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.