DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and barhl1a

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001017712.2 Gene:barhl1a / 550407 ZFINID:ZDB-GENE-050417-212 Length:299 Species:Danio rerio


Alignment Length:342 Identity:95/342 - (27%)
Similarity:131/342 - (38%) Gaps:126/342 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FSINDILTRSNPETRRMSSVDSEPE---PEKLKPSSDRERSISKSPP------------LCCRDL 73
            |.|..||:.     |..|...|:.|   |.:|.|.||.:...| |||            ...|.|
Zfish     9 FGIESILSH-----RASSPCMSKGECRSPAELSPRSDLDSGCS-SPPSPRRSSVEDAVQRRARAL 67

  Fly    74 GLYKLTQPKEIQPSARQP----SNYL--------QYYAAAMDNNNHHHQATGTSNSSAADYMQRK 126
            |   |..|.:|   ::||    |::|        :..||...     :.:||.|...|.|.|.: 
Zfish    68 G---LDSPLQI---SQQPRTVTSSFLIRDILADCKPLAACAP-----YSSTGQSAQDAEDCMDK- 120

  Fly   127 LAYFGSTLAAPLDMRRCTSNDSDC---DSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVF 188
                         :...:|:||:.   |......||..:||    .|.|.:.:::|.||:..|:.
Zfish   121 -------------LHSNSSSDSEYRVKDEADREISSSRDSP----NSRLKKPRKARTAFTDHQLA 168

  Fly   189 ELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQV 253
            :|||.|.:|:|||..:|.|:|.||.||:||||.|:||||.|.||:.....|              
Zfish   169 QLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLE-------------- 219

  Fly   254 LVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQ--------- 309
            |:.|.|:                              |..|   |...|.||||||         
Zfish   220 LLAEAGN------------------------------YSAL---QRMFPSPYFYPQSLVSNLDPG 251

  Fly   310 -----HKVPQPIPPPTQ 321
                 ::.|...|||.|
Zfish   252 PGLYLYRGPSAPPPPVQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 29/52 (56%)
barhl1aNP_001017712.2 TPP_enzymes <122..177 CDD:294952 18/58 (31%)
Homeobox 159..211 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.