DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and PRRX1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_073207.1 Gene:PRRX1 / 5396 HGNCID:9142 Length:245 Species:Homo sapiens


Alignment Length:251 Identity:61/251 - (24%)
Similarity:102/251 - (40%) Gaps:66/251 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 RQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSP 153
            |||:     ....:|:..:........|.|.:..:..:.|  |..:||..|.....:..|..:||
Human    11 RQPA-----LGGRLDSPGNLDTLQAKKNFSVSHLLDLEEA--GDMVAAQADENVGEAGRSLLESP 68

  Fly   154 PPLSSSPSESP------LSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSL 212
            .  .:|.|::|      |:.:.....:::|:|..|:.:|:..|||.|.:..|.....|.::|:.:
Human    69 G--LTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRV 131

  Fly   213 RLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDP 277
            .|||.:|::||||||.|.:|     :|.|:| |:|..                            
Human   132 NLTEARVQVWFQNRRAKFRR-----NERAML-ANKNA---------------------------- 162

  Fly   278 ALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASS 333
                    .|..:|.| .:..::.|.        ||:|.|.||...|:.|||..|:
Human   163 --------SLLKSYSG-DVTAVEQPI--------VPRPAPRPTDYLSWGTASPYSA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 21/52 (40%)
PRRX1NP_073207.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..103 10/41 (24%)
Homeobox 99..151 CDD:395001 20/51 (39%)
OAR 219..235 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 222..235
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.