DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and PRRX2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_057391.1 Gene:PRRX2 / 51450 HGNCID:21338 Length:253 Species:Homo sapiens


Alignment Length:294 Identity:68/294 - (23%)
Similarity:100/294 - (34%) Gaps:128/294 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCD 151
            :||:||.                   |:|.|.||                        ..|.:|.
Human    69 AAREPSG-------------------GSSGSEAA------------------------PQDGECP 90

  Fly   152 SPPPLSSSPSESPLSHDGSGLSRKK---RSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLR 213
            ||             ..||...|||   |:|..|:.:|:..|||.|.:..|.....|.|:|:.:.
Human    91 SP-------------GRGSAAKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRVN 142

  Fly   214 LTETQVKIWFQNRRYKTKRKQ---IQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGL 275
            |:|.:|::||||||.|.:|.:   :....|:||                 .:|:..||       
Human   143 LSEARVQVWFQNRRAKFRRNERAMLASRSASLL-----------------KSYSQEAA------- 183

  Fly   276 DPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPP-PTQSSSFVTASSASS--SPVP 337
                                                :.||:.| ||..|....:.:|||  |.||
Human   184 ------------------------------------IEQPVAPRPTALSPDYLSWTASSPYSTVP 212

  Fly   338 IPIPGAVRPQRTPCPSPNGQMMSVESGAE--SVH 369
            ...||:..| .||..:....:.|:...|:  |:|
Human   213 PYSPGSSGP-ATPGVNMANSIASLRLKAKEFSLH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 21/52 (40%)
PRRX2NP_057391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..113 21/99 (21%)
Homeobox 109..161 CDD:395001 20/51 (39%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 230..243 2/12 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.