DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and PAX6

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens


Alignment Length:469 Identity:99/469 - (21%)
Similarity:161/469 - (34%) Gaps:151/469 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGVSAAMAGLSK----SLT-----------TPFSINDILTRSNPETRRMSS--VDSEPEPE--- 50
            :|.:..|:||.::    |||           :|.|.:.:.|..:....::..  |:..|.|:   
Human    43 AAEIKRAVAGANRLPALSLTCGGRTCLWLKPSPGSDSHVCTGGHSGVNQLGGVFVNGRPLPDSTR 107

  Fly    51 ----KLKPSSDRERSISK----SPPLCCRDLGLYKLT---QPKEI---QPSARQP---SNYLQYY 98
                :|..|..|...||:    |.....:.||.|..|   :|:.|   :|....|   |...||.
Human   108 QKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYK 172

  Fly    99 -------------------AAAMDN-------NNHHHQATGTSNSSAADYMQRKLA--------- 128
                               ....||       |..............||.|..||.         
Human   173 RECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQMGADGMYDKLRMLNGQTGSW 237

  Fly   129 ------YFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRK-KRSRAAFSHAQ 186
                  |.|:::........|...:...::...:||:..:|..:.....|.|| :|:|.:|:..|
Human   238 GTRPGWYPGTSVPGQPTQDGCQQQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQ 302

  Fly   187 VFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQ---IQQHEAALLGASKR 248
            :..||:.|.:..|.....|..:|..:.|.|.::::||.|||.|.:|::   .|:.:|:      .
Human   303 IEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQAS------N 361

  Fly   249 VPVQVLVREDGSTT-YAHMAAP---------GAGHG-LDPALINIYRHQLQLAYGGLPLPQMQMP 302
            .|..:.:....||: |..:..|         |:..| .|.||.|        .|..||      |
Human   362 TPSHIPISSSFSTSVYQPIPQPTTPVSSFTSGSMLGRTDTALTN--------TYSALP------P 412

  Fly   303 FPYFYPQHKVPQPIPPPTQSSSFV-----------------------------------TASSAS 332
            .|.|...:.:|...|.|:|:||:.                                   |.|:..
Human   413 MPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGL 477

  Fly   333 SSP---VPIPIPGA 343
            .||   ||:.:||:
Human   478 ISPGVSVPVQVPGS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 17/52 (33%)
PAX6NP_001355839.1 PAX 85..209 CDD:128645 23/123 (19%)
Homeobox 295..348 CDD:395001 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.