DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and PAX3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_852124.1 Gene:PAX3 / 5077 HGNCID:8617 Length:505 Species:Homo sapiens


Alignment Length:256 Identity:71/256 - (27%)
Similarity:111/256 - (43%) Gaps:55/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 AAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSE-- 162
            |..|.|      |..|.||.:..::.|   ||.......|:.|..:.:|:..:...:....||  
Human   141 AVCDRN------TVPSVSSISRILRSK---FGKGEEEEADLERKEAEESEKKAKHSIDGILSERA 196

  Fly   163 -SPLSHDGSGLS---------RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTET 217
             :|.|.:||.:.         :::|||..|:..|:.||||.|.:..|.....|.|:|:..:|||.
Human   197 SAPQSDEGSDIDSEPDLPLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEA 261

  Fly   218 QVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDP-ALIN 281
            :|::||.|||.:. |||        .||::.:....|:             ||   |..| |:..
Human   262 RVQVWFSNRRARW-RKQ--------AGANQLMAFNHLI-------------PG---GFPPTAMPT 301

  Fly   282 IYRHQL-QLAYGGLPLPQMQMPFPYFYPQHKV--PQPIPPPTQSSSFVTASSASSSPVPIP 339
            :..:|| :.:|....:||....     |...|  |||:||.|...|.:.::..|||...:|
Human   302 LPTYQLSETSYQPTSIPQAVSD-----PSSTVHRPQPLPPSTVHQSTIPSNPDSSSAYCLP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 22/52 (42%)
PAX3NP_852124.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PAX 34..159 CDD:128645 7/23 (30%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 37..93
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 113..161 7/25 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..228 13/62 (21%)
Homeobox 222..276 CDD:395001 22/54 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..351 12/46 (26%)
Pax7 347..391 CDD:403540 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.