DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and nkx3.3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001013342.2 Gene:nkx3.3 / 503746 ZFINID:ZDB-GENE-050306-27 Length:240 Species:Danio rerio


Alignment Length:303 Identity:104/303 - (34%)
Similarity:136/303 - (44%) Gaps:89/303 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQP 86
            |.|||::||.:.: |..:..|.|.|.|.||....|.....:::...                 ..
Zfish     6 TSFSIHNILNQGH-ECGKNGSFDEEYEGEKRTQDSGSSVPVNRGAE-----------------SA 52

  Fly    87 SARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCD 151
            ..|..|..|...:.:.|.::...::||..||     ::|:                   :|.:.|
Zfish    53 QTRISSCVLVLESLSSDQHSCEEESTGEDNS-----LERR-------------------HDHEMD 93

  Fly   152 SPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTE 216
            ...|.|.|      ..|.:..|.|||||||||||||:||||||..|||||||||:::|.:|:|||
Zfish    94 QQKPQSCS------FEDSNPKSSKKRSRAAFSHAQVYELERRFNLQRYLSGPERADLAGALKLTE 152

  Fly   217 TQVKIWFQNRRYKTKRKQIQQHEAALLGA------SKRVPVQVLVREDGSTTYAHMAAPGAGHGL 275
            ||||||||||||||||:|:    ||.|..      :|||.|:||||.|                 
Zfish   153 TQVKIWFQNRRYKTKRRQM----AAELATTPTTTLAKRVAVKVLVRND----------------- 196

  Fly   276 DPALINIYRHQLQLAYGGLP---LPQMQMPFPYFYPQHKVPQP 315
                      |.|.....||   :|.:...||| ||.....||
Zfish   197 ----------QRQYNTEDLPSPSVPPLYQSFPY-YPYMFCFQP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 43/52 (83%)
nkx3.3NP_001013342.2 Homeobox 114..167 CDD:278475 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587935
Domainoid 1 1.000 105 1.000 Domainoid score I6597
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4733
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003099
OrthoInspector 1 1.000 - - otm24386
orthoMCL 1 0.900 - - OOG6_108109
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4759
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.