DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Noto

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001178943.1 Gene:Noto / 502857 RGDID:1562910 Length:245 Species:Rattus norvegicus


Alignment Length:225 Identity:64/225 - (28%)
Similarity:91/225 - (40%) Gaps:61/225 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEI 84
            |.:.||:..||.|  |||                    ||.|.:..|...|..|....::| .::
  Rat    40 LESSFSVEAILAR--PET--------------------REHSATSLPLSTCTSLNFGSVSQ-YQV 81

  Fly    85 QPSARQPSNYLQYY----------AAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLD 139
            .|.......:|..|          .:.|...|..|.           :.|:.|...||.|.:.|.
  Rat    82 LPWVCSTGTWLPTYLSVGIYPMCSMSCMPGLNVTHL-----------FCQQGLRLTGSELPSCLG 135

  Fly   140 MRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPE 204
                           ||..:|:.:...|:..  ..:||.|..||..|:.|||:.||:|..|.|.|
  Rat   136 ---------------PLKRAPTVNLQDHNTE--RHQKRVRTMFSEQQLGELEKVFAKQHNLVGKE 183

  Fly   205 RSEMAKSLRLTETQVKIWFQNRRYKTKRKQ 234
            |:::|..|.|||.||:|||||||.|.:::|
  Rat   184 RAQLAARLHLTENQVRIWFQNRRVKYQKQQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 29/52 (56%)
NotoNP_001178943.1 Homeobox 158..209 CDD:278475 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.