DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nobox

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001178942.1 Gene:Nobox / 502759 RGDID:1563929 Length:524 Species:Rattus norvegicus


Alignment Length:307 Identity:67/307 - (21%)
Similarity:106/307 - (34%) Gaps:109/307 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PPLSSSPSE--SPLSHDGSGLSR---------KKRSRAAFSHAQVFELERRFAQQRYLSGPERSE 207
            |.:|:.|.:  :||:.....|.:         :|::|..:...|:.||||.|.:..|....:|.|
  Rat   103 PSMSAGPGQVPNPLNFRERDLKKEPLEATCQFRKKTRTLYRSDQLEELERIFQEDHYPDSDKRHE 167

  Fly   208 MAKSLRLTETQVKIWFQNRRYKTKR-KQIQQHE------------------AALLGASKR----- 248
            :|:.:.:|..::.:||||||.|.:: :::.:.|                  ..|||....     
  Rat   168 IAQMVGVTPQRIMVWFQNRRAKWRKVEKLNEKEDNNGPAPPRANSSQCRSAPELLGPMPTDLEPG 232

  Fly   249 -VPVQ----------VLVREDGSTTYAHMAAPGAGHGLDPALIN---IYRHQLQLAYGGLPLPQM 299
             ||.:          ||:..|.:.|.:..........:.|.|::   |.|..|.|..|....||:
  Rat   233 PVPPENILDGFTEPPVLLTSDQTLTSSQHNESAERVAVTPPLLSPPPIRRTNLPLPLGPFQAPQV 297

  Fly   300 QMPF------------------------PYFY-------PQH-------------KVPQ-PIPPP 319
            ..|.                        |..|       ||.             :.|| |:.||
  Rat   298 LPPLRDVPGSDSIYKDKPCGSWGTSITSPPIYSNLEDMGPQDYQASNQLGSFQLTQAPQTPLFPP 362

  Fly   320 TQSSSFVTASSASSSPVPIPIPGAVRPQRTPCP--SPNGQMMSVESG 364
            .||      ......|.|:|||       :|.|  .|...:.|...|
  Rat   363 LQS------QVPYLPPFPLPIP-------SPLPFLPPEDSLFSFPFG 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 19/52 (37%)
NoboxNP_001178942.1 COG5576 82..>192 CDD:227863 26/88 (30%)
Homeobox 138..191 CDD:278475 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.