DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Emx1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_575584.5 Gene:Emx1 / 500235 RGDID:1564002 Length:290 Species:Rattus norvegicus


Alignment Length:238 Identity:65/238 - (27%)
Similarity:90/238 - (37%) Gaps:80/238 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ESAGVS----AAMAGLSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKS 65
            |:|.||    ||.||.|:||                         ...||.:.|.:....:::..
  Rat    92 ETAFVSGFPAAAAAGASRSL-------------------------YGGPELVFPEAMNHPALTVH 131

  Fly    66 PPLCCRDLGLYKLTQPKE-IQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAY 129
            |   ...||...|..|.. .....|.|   |.:|...:.|.                       :
  Rat   132 P---AHQLGSSSLQPPHSFFSAQHRDP---LHFYPWVLRNR-----------------------F 167

  Fly   130 FGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRF 194
            ||....|                    |..|.:..|.| |....:.||.|.|||.:|:..|||.|
  Rat   168 FGHRFQA--------------------SEVPQDGLLLH-GPFARKPKRIRTAFSPSQLLRLERAF 211

  Fly   195 AQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQ 237
            .:..|:.|.||.::|.||.|:|||||:||||||.|.||:::::
  Rat   212 EKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 29/52 (56%)
Emx1XP_575584.5 COG5576 141..>251 CDD:227863 48/156 (31%)
Homeobox 196..248 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.