DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Hoxa13

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001258284.1 Gene:Hoxa13 / 500129 RGDID:1562483 Length:386 Species:Rattus norvegicus


Alignment Length:174 Identity:47/174 - (27%)
Similarity:72/174 - (41%) Gaps:36/174 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRK----LAYFGSTLAAPLDM-- 140
            :|....|::.:.|.|.|||   ...||||       ....|:...    |...|.:...||.:  
  Rat   217 EEFSSRAKEFAFYHQGYAA---GPYHHHQ-------PVPGYLDMPVVPGLGGPGESRHEPLGLPM 271

  Fly   141 ---------------RRCTSNDSDCDSPPPLSSSPSESPLSH--DGSGLSRKKRSRAAFSHAQVF 188
                           ..|....:   .||.|..|.....:||  |.|...|.::.|..::..|:.
  Rat   272 ESYQPWALPNGWNGQMYCPKEQT---QPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLK 333

  Fly   189 ELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR 232
            ||||.:|..::::..:|..::.:..|:|.||.|||||||.|.|:
  Rat   334 ELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 20/52 (38%)
Hoxa13NP_001258284.1 HoxA13_N 85..220 CDD:289085 1/2 (50%)
HOX 320..376 CDD:197696 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.