DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bap and Hoxb7

DIOPT Version :9

Sequence 1:	NP_732637.1	Gene:	bap / 42537	FlyBaseID:	FBgn0004862	Length:	382	Species:	Drosophila melanogaster
Sequence 2:	NP_001017480.1	Gene:	Hoxb7 / 497985	RGDID:	1559918	Length:	219	Species:	Rattus norvegicus

Alignment Length:	64	Identity:	32/64 - (50%)
Similarity:	41/64 - (64%)	Gaps:	1/64 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   170 SGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRK 233
            ||..| ||.|..::..|..|||:.|...|||:...|.|:|.:|.|||.|:||||||||.|.|::
  Rat   133 SGTER-KRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 195

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bap	NP_732637.1	Homeobox	178..231	CDD:278475	26/52 (50%)
Hoxb7	NP_001017480.1	Antp-type hexapeptide	126..131
		Homeobox	141..193	CDD:278475	26/51 (51%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	193..219		1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910