DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and dlx2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001008061.1 Gene:dlx2 / 493423 XenbaseID:XB-GENE-852891 Length:285 Species:Xenopus tropicalis


Alignment Length:305 Identity:86/305 - (28%)
Similarity:121/305 - (39%) Gaps:61/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PSSDRERSISKSP-----PLCCRDLGLYKLTQPKEIQPSARQPSNYL---QYYAAAMDNNNHHHQ 110
            |||. ..|:.||.     |:.......|...|.::....|..|...|   |::.||::       
 Frog    18 PSSS-YHSLHKSQESPTLPVSTATDSSYYTNQQQQQHCGAGSPYGQLGSYQFHGAALN------- 74

  Fly   111 ATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSE---SPLSHDGSGL 172
              |.|.|:.:    ..|.|.||          .:|......||.|..:.|.:   .|.....:|.
 Frog    75 --GISYSTKS----YDLTYSGS----------YSSYGPYGTSPSPPHNDPEKEDCEPEVRMVNGK 123

  Fly   173 SRK-KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQ 236
            .:| ::.|..:|..|:..|:|||.:.:||:.|||:|:|.||.||:|||||||||||.|.|:    
 Frog   124 PKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKK---- 184

  Fly   237 QHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQ-LQLAYGGLPLP--- 297
                  :..|..:|...|.....|.|.....|..|.....|       || ||.|..|..|.   
 Frog   185 ------MWKSGEIPSDQLPVGSESPTCNSPPASTATWDFGP-------HQRLQGAASGSALQSSN 236

  Fly   298 QMQMPFPYF--YPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPI 340
            ....|.|:.  |..::...| .|..||:..:........| |.|:
 Frog   237 SASSPSPFLGNYSWYQTSNP-APHLQSNPLLQQHHLHHHP-PAPV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 30/52 (58%)
dlx2NP_001008061.1 DLL_N 29..107 CDD:315147 20/100 (20%)
Homeobox 130..183 CDD:306543 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.