DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and NKX2-2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_002500.1 Gene:NKX2-2 / 4821 HGNCID:7835 Length:273 Species:Homo sapiens


Alignment Length:317 Identity:104/317 - (32%)
Similarity:134/317 - (42%) Gaps:72/317 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SLT---TPFSINDILTRSNPETR-RMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDL-GLYKL 78
            |||   |.||:.|||  ..|:|. ...||...||.|...|...:     ::.||....| .:..|
Human     2 SLTNTKTGFSVKDIL--DLPDTNDEEGSVAEGPEEENEGPEPAK-----RAGPLGQGALDAVQSL 59

  Fly    79 TQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRC 143
            ........|:..|  |.::.|                   :.:.:|..|  .|....||      
Human    60 PLKNPFYDSSDNP--YTRWLA-------------------STEGLQYSL--HGLAAGAP------ 95

  Fly   144 TSNDSDCDSPPPLSSSPSESPLSHD------GSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSG 202
             ..||...||.|   |..||| .:|      |....:|::.|..||.||.:||||||.||||||.
Human    96 -PQDSSSKSPEP---SADESP-DNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSA 155

  Fly   203 PERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQ-HEAALLGASKRVPVQVLVREDGSTTYA-- 264
            |||..:|..:|||.|||||||||.|||.||.:.:: .|...|.:.:||.|.|||| ||...:|  
Human   156 PEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVR-DGKPCHALK 219

  Fly   265 --HMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPY---FYPQHKVPQPI 316
              .:||.....|:..:           ||....|..||....|   ..||:....|:
Human   220 AQDLAAATFQAGIPFS-----------AYSAQSLQHMQYNAQYSSASTPQYPTAHPL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 36/52 (69%)
NKX2-2NP_002500.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 20/60 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 14/51 (27%)
Homeobox 131..185 CDD:395001 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450160at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.