DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and hbn

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:412 Identity:97/412 - (23%)
Similarity:153/412 - (37%) Gaps:125/412 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PEKLKPSSDRERSISKSPPLCCRDLGLYKLTQ-------------PKEI---QPSARQPSNYLQY 97
            |..::|:..:|..:|       |...:|.:.|             |.|:   .|....|.:....
  Fly    17 PPAMRPAPVQESPVS-------RPRAVYSIDQILGNQHQIKRSDTPSEVLITHPHHGHPHHIHHL 74

  Fly    98 YAAAMDNNNH--HHQATGTS---NSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLS 157
            :::..:.:||  |.|....|   :.|.....|::|........:|.:    |....|.|:...||
  Fly    75 HSSNSNGSNHLSHQQQQQHSQQQHHSQQQQQQQQLQVQAKREDSPTN----TDGGLDVDNDDELS 135

  Fly   158 SSPSESPLSHDGSGLSRK---KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQV 219
            ||.:.   .||.|.:.|.   :|||..|:..|:.:|||.|.:.:|.....|.::|..|.|:|.:|
  Fly   136 SSLNN---GHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARV 197

  Fly   220 KIWFQNRRYKTKRKQ--IQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLD------ 276
            ::||||||.|.::::  :.|.:|.           .|:.|.|...:. :..|...|||.      
  Fly   198 QVWFQNRRAKWRKREKFMNQDKAG-----------YLLPEQGLPEFP-LGIPLPPHGLPGHPGSM 250

  Fly   277 -----PALINIYRH--QLQLAYGGLPLPQMQM----PFPYF------------------------ 306
                 |....:::|  ....|..|| |||..|    ..|.|                        
  Fly   251 QSEFWPPHFALHQHFNPAAAAAAGL-LPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAA 314

  Fly   307 -------YPQH-------KVPQPIPPPTQSSSFVTASSASSSP--VPIPIPGAVRPQRTPCPSPN 355
                   |||:       .....:.||..:      ||...||  ||.|.|    |..||....|
  Fly   315 AAAASAGYPQNLSLHAGLSAMSQVSPPCSN------SSPRESPKLVPHPTP----PHATPPAGGN 369

  Fly   356 --GQMMS---VESGAESVHSAA 372
              |.:::   :.:.|:|.:|||
  Fly   370 GGGGLLTGGLISTAAQSPNSAA 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 22/52 (42%)
hbnNP_788420.1 Homeobox 156..209 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.