DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and repo

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster


Alignment Length:290 Identity:69/290 - (23%)
Similarity:103/290 - (35%) Gaps:90/290 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KLTQPKEI-------QPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTL 134
            ||.:|.|:       ......||:     ::.:.|...:......|:|||...:|......|...
  Fly   223 KLKKPDEMCSQLEAGGAGVTPPSS-----SSTVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGVA 282

  Fly   135 AAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRY 199
            |                  |......|.|....|.:|: :||::|..|:..|:.||||.|.:..|
  Fly   283 A------------------PAAKKDGSSSKKKGDPNGI-KKKKTRTTFTAYQLEELERAFERAPY 328

  Fly   200 LSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYA 264
            .....|.|:|..|.|:|::|::||||||.|.::     ||          |.:       .|.|.
  Fly   329 PDVFAREELAIKLNLSESRVQVWFQNRRAKWRK-----HE----------PPR-------KTGYI 371

  Fly   265 HMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTAS 329
            ..:.|... .|:|               |...|    ||. .|||   ...:.||....|:.:..
  Fly   372 KTSTPPTA-TLNP---------------GTLAP----PFT-SYPQ---TTTVTPPGSMDSWTSYQ 412

  Fly   330 SASSSPVPIPIPGAVRPQ---RTPCPSPNG 356
            :          |..:.||   .:|..||.|
  Fly   413 T----------PYELTPQFSLLSPAASPYG 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 23/52 (44%)
repoNP_477026.1 Homeobox 313..360 CDD:278475 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.