DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and E5

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster


Alignment Length:426 Identity:99/426 - (23%)
Similarity:128/426 - (30%) Gaps:211/426 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGVSAAMAGLSKSLTT----------PFSINDIL----TRSNPETRRMSSVDSEPEPEKLKPSS 56
            |:.|:|:...:|.|.|.          .|||:.|:    |||.|   ...||.|.|.|....|:|
  Fly    24 SSSVAASSTSVSASSTVSASASSKPKLAFSIDSIVGESSTRSAP---LRVSVISSPPPRSESPAS 85

  Fly    57 ------------------------DRERS-----ISKSP-------------------------- 66
                                    ||.||     :|:||                          
  Fly    86 PTNTNNSGRRTPRGYIYCRRRDSLDRSRSPQRSPVSRSPSPPNAGGNPAAAGNTAKSGDPSSGTG 150

  Fly    67 ---------PLCCRDLGLY-KLTQPKEI---------QPSARQPSNYLQY-YAAAMDNNNHHHQA 111
                     ||...:|.|. ..|.|..:         .||...|....|: .|||:   .|||| 
  Fly   151 NPPTLIRPLPLPAPNLALIGNRTSPNAMAVRMAGPPHPPSQPPPFLAAQFQMAAAL---AHHHQ- 211

  Fly   112 TGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSG----- 171
                  ......|::|                          ||:.:.|...|..|...|     
  Fly   212 ------QQQQQQQQQL--------------------------PPVPTGPPHGPHPHLPPGQIPLG 244

  Fly   172 ------------------------------------LSR-------------------KKRSRAA 181
                                                |||                   .||.|.|
  Fly   245 IFPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIFPRFPGNFLFQPFRKPKRVRTA 309

  Fly   182 FSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGAS 246
            ||..|:.:||..|....|:.|.||.::|:.|.|||||||:||||||  ||.|::||...      
  Fly   310 FSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRR--TKHKRMQQEGG------ 366

  Fly   247 KRVPVQVLVREDGSTTYAHMAAP----GAGHGLDPA 278
                       |||.|.::..:.    |.|.|.|.|
  Fly   367 -----------DGSDTKSNKGSSSGGGGGGDGEDDA 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 27/52 (52%)
E5NP_524825.1 Homeobox 307..359 CDD:278475 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.