DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and MSX1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_002439.2 Gene:MSX1 / 4487 HGNCID:7391 Length:303 Species:Homo sapiens


Alignment Length:267 Identity:74/267 - (27%)
Similarity:105/267 - (39%) Gaps:77/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGVSAAMAG--------LSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSI 62
            :|..:|||..        :|.|| .|||:..::.    :.|:..:.:|     .|.||...:.:.
Human    36 AAATAAAMGADEEGAKPKVSPSL-LPFSVEALMA----DHRKPGAKES-----ALAPSEGVQAAG 90

  Fly    63 SKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKL 127
            ..:              ||..:.|                          |:..:..|....|.|
Human    91 GSA--------------QPLGVPP--------------------------GSLGAPDAPSSPRPL 115

  Fly   128 AYF--GSTLAAPLDM----------RRCTSNDSDCDSPPPLS--SSPSESPLSHDGSGLSRKKRS 178
            .:|  |..|..|.|.          .|.....|...||||..  |.|:.:...|     ...::.
Human   116 GHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKH-----KTNRKP 175

  Fly   179 RAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALL 243
            |..|:.||:..|||:|.|::|||..||:|.:.||.||||||||||||||.|.||.|..:.|...:
Human   176 RTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKM 240

  Fly   244 GASKRVP 250
            .|...:|
Human   241 AAKPMLP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 32/52 (62%)
MSX1NP_002439.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..55 4/18 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..117 12/92 (13%)
PTZ00449 <105..>248 CDD:185628 55/148 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..174 9/45 (20%)
Homeobox 175..229 CDD:395001 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.