DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and emx1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001005459.1 Gene:emx1 / 448058 XenbaseID:XB-GENE-920144 Length:233 Species:Xenopus tropicalis


Alignment Length:241 Identity:67/241 - (27%)
Similarity:91/241 - (37%) Gaps:80/241 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FSINDILTRSNPETRRMSSVDSEP-EPEKLK-PSSDRERSIS----------------------K 64
            |:|..::.:.||    :||  .|| .|..|. |.:..|..:|                      .
 Frog    10 FTIESLVAKDNP----LSS--EEPLRPAALPYPGAPAEAFVSGFPSPAGRSLYNNPELVFPETVS 68

  Fly    65 SPPLCC--RDLGLYKLTQPKE-IQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRK 126
            .|||..  ..||...|..|.. ..|..|.|   |.:|...:.|....|:..|      .|..|..
 Frog    69 HPPLTVHPHQLGASHLQHPHSFFAPQHRDP---LNFYPWVLRNRFFGHRFQG------GDVSQES 124

  Fly   127 LAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELE 191
            |...|                       |.:..|               ||.|.|||.:|:..||
 Frog   125 LLLHG-----------------------PFARKP---------------KRIRTAFSPSQLLRLE 151

  Fly   192 RRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQ 237
            |.|.:..|:.|.||.::|.||.|:|||||:||||||.|.||:::::
 Frog   152 RAFEKNHYVVGAERKQLASSLSLSETQVKVWFQNRRTKYKRQKLEE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 29/52 (56%)
emx1NP_001005459.1 COG5576 85..>194 CDD:227863 48/155 (31%)
Homeobox 139..192 CDD:365835 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..233 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.