DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and dlx5

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001004778.1 Gene:dlx5 / 447997 XenbaseID:XB-GENE-853057 Length:289 Species:Xenopus tropicalis


Alignment Length:177 Identity:54/177 - (30%)
Similarity:80/177 - (45%) Gaps:31/177 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PKEIQP----SARQPSNYLQYYAAAMDNNNHHHQATGTS-----------------NSSAADYMQ 124
            |.:..|    |....|.|  |.......:.||...:.||                 |.:|.:|..
 Frog    24 PSQDSPTLPESTATDSGY--YSPGGAAGHPHHGYCSPTSATYGKALNAYQYQYHGMNGAAGNYPG 86

  Fly   125 RKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSE---SPLSHDGSGLSRK-KRSRAAFSHA 185
            :..:.:|  ..:|.......|...:...||  ||.|.:   .|.....:|..:| ::.|..:|..
 Frog    87 KAYSDYG--YGSPYHPHHQYSGAYNRVQPP--SSQPEKEVSEPEVRMVNGKPKKIRKPRTIYSSF 147

  Fly   186 QVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR 232
            |:..|:|||.:.:||:.|||:|:|.||.||:|||||||||:|.|.|:
 Frog   148 QLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 29/52 (56%)
dlx5NP_001004778.1 DLL_N 26..118 CDD:315147 19/97 (20%)
Homeobox 140..193 CDD:306543 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.