DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and ro

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster


Alignment Length:330 Identity:85/330 - (25%)
Similarity:125/330 - (37%) Gaps:130/330 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NPETRRMSSVD--------SEPEPEKLKPSSDRE-----------RSI----------SKSPPLC 69
            :|..:|..|:|        |.|:    :|||.|:           ||.          :..||.|
  Fly    14 SPGIKRSDSLDPIANTTILSVPQ----RPSSPRQFFERLYGHLETRSSENGEIDVGTHAHKPPPC 74

  Fly    70 ----CRDLGLYKLTQPKEIQPSARQPS--------------NYLQYYAAAMDNNNHHHQATGTSN 116
                ..|.|  .::.| :|..|..:.|              :|.|:.:.....::|||.      
  Fly    75 DTPYHSDGG--SVSSP-DISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHH------ 130

  Fly   117 SSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPP-LSSSPSESPL------------SHD 168
             .....:.:||:|.                     |||| :::..:.:|:            .|.
  Fly   131 -HPPQLVHQKLSYV---------------------SPPPAIAAGGAANPVLPHAFPAGFPSDPHF 173

  Fly   169 GSGLS-----------RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIW 222
            .:|.|           |::|.|..||..|...||..|.:..|:|...|.|:|::|||||||:|||
  Fly   174 SAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIW 238

  Fly   223 FQNRRYKTKR---KQIQQH----------EAALLG-ASKRVP-------VQVLVREDGSTTYAHM 266
            |||||.|.||   .||.||          .::::| |:..:|       |.|.|   |...||..
  Fly   239 FQNRRAKDKRIEKAQIDQHYRNFVVANGFMSSIMGQAATTMPPGGVTGGVAVGV---GLNYYAAA 300

  Fly   267 AAPGA 271
            |.|.|
  Fly   301 ATPAA 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 28/52 (54%)
roNP_524521.1 Homeobox 196..247 CDD:278475 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.