DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and btn

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:140 Identity:47/140 - (33%)
Similarity:71/140 - (50%) Gaps:24/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TSNSSAADYMQRKLAYFGSTLAAPLDMRRCT-SNDSDCDSPPPLSSS-PSE-SPLSHDGSGLSRK 175
            :::||.|||.:             |:...|. :||....:..|.... ||: |.|    ..:|..
  Fly    39 SASSSYADYNK-------------LETNWCNEANDQWLQNEAPTGQELPSQRSKL----RAISSN 86

  Fly   176 KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEA 240
            ::.|.|||..|:.:||..|....||:...|.|:|.:|.|||.|||:||||||.|.||.::::.: 
  Fly    87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQ- 150

  Fly   241 ALLGASKRVP 250
               |:|.:.|
  Fly   151 ---GSSAKTP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 27/52 (52%)
btnNP_732768.1 Homeobox 90..142 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.