DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and C15

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster


Alignment Length:293 Identity:78/293 - (26%)
Similarity:121/293 - (41%) Gaps:64/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQP 81
            |.|...||||:.:|              |:|........::....:|.||.....:....:..:.
  Fly    69 SSSENLPFSISRLL--------------SKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEE 119

  Fly    82 KEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKL---AYFGSTLAAPLDMRRC 143
            ||:   .:|..:.|.|..|....|:       |..|:||.|....|   |..|..|..|......
  Fly   120 KEL---LQQEDHDLAYKLATSIANS-------TYGSAAALYSYPHLYPSAAGGHVLRVPPQRTPL 174

  Fly   144 TSNDSDCDSPPPL---------------SSSPSESPLSHDGSGLS--RKKRSRAAFSHAQVFELE 191
            |.      :.|||               ::.|....:.|.....:  ::|:.|.:|:..||.|||
  Fly   175 TW------ALPPLHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELE 233

  Fly   192 RRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVR 256
            :||.:|:||:..||:.:|:.|::|:.|||.||||||.|.:|:..::.||....|::.  :..|..
  Fly   234 KRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRL--MLSLQA 296

  Fly   257 EDGSTTYAHMAAP------------GAGHGLDP 277
            |..|..:|..:||            .|.|||.|
  Fly   297 EAISKGFAPPSAPLGSQGGVNGAPLAALHGLQP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 27/52 (52%)
C15NP_476873.2 COG5576 <196..315 CDD:227863 40/120 (33%)
Homeobox 220..273 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.