DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and lbe

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster


Alignment Length:355 Identity:95/355 - (26%)
Similarity:130/355 - (36%) Gaps:128/355 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSA 88
            |||.|||..|  |.:|..||...|....|.|.:  .|.|:.|..|      |...|:|.::.|:|
  Fly   134 FSIADILGHS--EKQREESVSPPPNANLLAPPA--SRPIAPSGGL------LQPRTEPLDVHPAA 188

  Fly    89 RQ---------------------------PSNYLQY-YAAAMDNNNHHHQATGTSNSSAADYMQR 125
            ..                           ||..|.| ...|:|   :|.|.....|:.|     :
  Fly   189 AAAMLLPSGQIVRPWDHLLGPTMPVRPFIPSALLHYEQRLALD---YHRQLQEHFNAQA-----Q 245

  Fly   126 KLAYFGSTLA--------APLDMRRCTSNDS-DCDSP-------------------------PPL 156
            .|.:.|...|        :....|..:||.| :|.||                         .|.
  Fly   246 LLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPT 310

  Fly   157 SSSPS--ESPL-------------SHDGSGL---------SRKKRSRAAFSHAQVFELERRFAQQ 197
            .|..|  ::||             |.|.|.|         .:|::||.||::.|:||||:||..|
  Fly   311 GSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQ 375

  Fly   198 RYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR------------KQIQQHEAAL-----LGA 245
            :|||..:|.|:|.||.|:..||..||||||.|.||            |....|::.|     |..
  Fly   376 KYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDSVKVFSAHKSFLENVNDLSI 440

  Fly   246 SKRVPVQVLVREDGSTTYAHMAAPGAGHGL 275
            .|:.|:.       .:....:||..|..|:
  Fly   441 LKKKPMH-------ESDMVGLAAAAAAAGM 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 30/52 (58%)
lbeNP_524435.2 Homeobox 356..410 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.