DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HHEX

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster


Alignment Length:284 Identity:75/284 - (26%)
Similarity:112/284 - (39%) Gaps:79/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGVS---------AAMA-GLSKSLTTP-----FSINDILTRSNPETRRMSSVDSEPEPEKLKPS 55
            :||::         |::| |.|.:..||     .:|.|:...:......|.|:||.   ..|.|:
  Fly    41 TAGIATPHALAMPKASLATGSSSAAPTPSPSSATNIYDLSREAAAAQYAMKSMDSS---AVLAPT 102

  Fly    56 SDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAA 120
            |.|...|...|...     .|:.....:..||...|                |.||...:.::|.
  Fly   103 SLRFNPIYPDPASL-----FYQQVLQLQKNPSLFMP----------------HFQAAAVAAAAAV 146

  Fly   121 DYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDS-PPPLSSS--------PSES-PLSHDGSGLSRK 175
                :..||...  .:|..|        ||:. |.|.|::        |:.| .:|:.|   .::
  Fly   147 ----QPTAYCDQ--YSPFTM--------DCEGFPNPASAAAALYCNAYPAASFYMSNFG---VKR 194

  Fly   176 KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEA 240
            |..:..|:..|...||.|||..:|||..||..:|..|:||:.|||.||||||.|.:|..:.:..|
  Fly   195 KGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLSKRSA 259

  Fly   241 ALLG-------------ASKRVPV 251
            :..|             :|..|||
  Fly   260 SAQGPIAGAAVGSPSSASSSSVPV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 26/49 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.