DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and CG15696

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:172 Identity:44/172 - (25%)
Similarity:75/172 - (43%) Gaps:31/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LQYYAAAMDNNNHHHQAT-------GTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDS 152
            ||...|::..:.:.|.|:       |:..:|||:.......:...|...|..:.|....::    
  Fly    27 LQRLRASLPFHPYAHPASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKLPRALRQNA---- 87

  Fly   153 PPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTET 217
              |...:|...|              |..|:..|:..||..:.:..|||..:.:::|.||.||.|
  Fly    88 --PAKRTPGRLP--------------RIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNT 136

  Fly   218 QVKIWFQNRRYKTKRKQIQQHEAA----LLGASKRVPVQVLV 255
            :|||||||||.:.:|::.::.|:.    ...||...|..::|
  Fly   137 RVKIWFQNRRARERREKREKDESCDSTFSSNASSPEPEMIVV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 23/52 (44%)
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I3229
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.