DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and CG18599

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster


Alignment Length:253 Identity:66/253 - (26%)
Similarity:105/253 - (41%) Gaps:82/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 NNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDS--------------PP 154
            |||:::...|.|||             |:..::|      :.|:.:|||              |.
  Fly   214 NNNNNNNNNGGSNS-------------GNNNSSP------SVNNFNCDSVAGNGRYLHGGHQHPH 259

  Fly   155 P-----------LSSSPS----------------ESPL----------SHDGSGLSRKKRSRAAF 182
            |           :.::||                ::.|          ||..|.| :.||.|..|
  Fly   260 PHQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQQQATLSFQREKLKSDSHKKSAL-KNKRVRTIF 323

  Fly   183 SHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQ--QHEAALLGA 245
            :..|:..||..|.:|:|:.||||..:|.:|:|||.|||:||||||.|.::..::  |...||:..
  Fly   324 TPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQ 388

  Fly   246 SKRVPVQVLVRE-DGSTTYAHMAAPGAGHGLDPALINIY-------RHQLQLAYGGLP 295
            ::.....:|..: ..|...||..:....:|...|..::.       :|.|.|: |.||
  Fly   389 TQLPGTSLLGNQVSVSANAAHSVSTERTNGCSAASPSLQEEDNEDSKHSLSLS-GALP 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 27/52 (52%)
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.