DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and abd-A

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster


Alignment Length:77 Identity:32/77 - (41%)
Similarity:46/77 - (59%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 SPSESPLSHDGSGLS--RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKI 221
            ||.|..:..|.:|.:  .::|.|..::..|..|||:.|....||:...|.|:|.:|.|||.|:||
  Fly   380 SPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKI 444

  Fly   222 WFQNRRYKTKRK 233
            ||||||.|.|::
  Fly   445 WFQNRRMKLKKE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 25/52 (48%)
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 25/51 (49%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.