DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and ems

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster


Alignment Length:340 Identity:76/340 - (22%)
Similarity:116/340 - (34%) Gaps:130/340 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SAAMA-GLSKSLTTPFSINDILTRSNPETRRMSSV-----DSEPEPEKLKPSSDRERSISKSPPL 68
            :|||| |||          .:.||.:|||.:....     :..|.|..::.:.:..:.|  .|| 
  Fly   150 NAAMASGLS----------PLQTRLSPETEQPQMAVSLKRERSPAPPAMEQAENPAQRI--QPP- 201

  Fly    69 CCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGST 133
                     .|.||.:.|.:.|||:    ....:.::.|.............:|.:..:.:.|. 
  Fly   202 ---------HTPPKSVSPQSSQPSS----SPTLLISSPHATPPQQQQQQPPPNYPKPAMMHPGG- 252

  Fly   134 LAAPL---------------------DMRRCTSNDSDCDSPPPLSSSPSESPLSHD--------- 168
             |.|:                     .|.:......|..:.||..::|.|.|..|:         
  Fly   253 -AGPMMMPGMPPAGLVRPFPMGPGGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQF 316

  Fly   169 ---------------------------------GSGLSR-------------------------- 174
                                             ..|::|                          
  Fly   317 QMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPGSFL 381

  Fly   175 ------KKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRK 233
                  .||.|.|||.:|:.:||..|...:|:.|.||..:|::|.|:|||||:||||||.|.||.
  Fly   382 VPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRM 446

  Fly   234 QIQQHEAALLGASKR 248
            | |:.|....|.|:|
  Fly   447 Q-QEDEKGGEGGSQR 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 27/52 (52%)
emsNP_731868.1 Homeobox 392..444 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.