DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Antp

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:265 Identity:59/265 - (22%)
Similarity:99/265 - (37%) Gaps:77/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLG------LYKLTQPKEIQPSARQPSNY 94
            :|.....|..:.:.::.:||.::::..::..|   :.|.      ..::|.|::.|   :||..|
  Fly   101 QTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAP---QQLQQQLPQVTQQVTHPQQQQ---QQPVVY 159

  Fly    95 LQYYAAA----------------MDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRC 143
            ......|                :|..:.||.   .:..:...:|....|..|.|.....|:...
  Fly   160 ASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHM---NAQMTLPHHMGHPQAQLGYTDVGVPDVTEV 221

  Fly   144 TSNDSDC-----------------------DSPPPL-------SSSPSESPLSHDGSGL------ 172
            ..|..:.                       ..||.:       .:.||::|.| ..||:      
  Fly   222 HQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNS-QSSGMPSPLYP 285

  Fly   173 ---------SRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRY 228
                     ..:||.|..::..|..|||:.|...|||:...|.|:|.:|.|||.|:||||||||.
  Fly   286 WMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRM 350

  Fly   229 KTKRK 233
            |.|::
  Fly   351 KWKKE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 21/148 (14%)
Homeobox 301..354 CDD:395001 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.