DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Dfd

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster


Alignment Length:198 Identity:57/198 - (28%)
Similarity:86/198 - (43%) Gaps:50/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SKSPP----LCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYM 123
            |..||    |..::|||....:.:|..|:.:|    ||.....:..::     .|:.|...::..
  Fly   248 STEPPTNTALGLQELGLKLEKRIEEAVPAGQQ----LQELGMRLRCDD-----MGSENDDMSEED 303

  Fly   124 QRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPL---SHDG-------------SGL 172
            :..|......|.         |||:|.|    |..|.|:..|   :.||             :|:
  Fly   304 RLMLDRSPDELG---------SNDNDDD----LGDSDSDEDLMAETTDGERIIYPWMKKIHVAGV 355

  Fly   173 S--------RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYK 229
            :        ..||.|.|::..|:.|||:.|...|||:...|.|:|.:|.|:|.|:||||||||.|
  Fly   356 ANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMK 420

  Fly   230 TKR 232
            .|:
  Fly   421 WKK 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
DfdNP_477201.1 Homeobox 370..422 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.