DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and zen

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster


Alignment Length:297 Identity:78/297 - (26%)
Similarity:118/297 - (39%) Gaps:49/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SNYLQYYAAAMDNNNHHHQA-TGTSNSSAADYMQRKLAYFG-----STLAAPLDMRRCTSND--- 147
            |:.:.||..        ||| .|:.::..::.....|.| |     :.:..|.:..:..||.   
  Fly     2 SSVMHYYPV--------HQAKVGSYSADPSEVKYSDLIY-GHHHDVNPIGLPPNYNQMNSNPTTL 57

  Fly   148 SDCDSPPPLS----SSPSESPL--SHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERS 206
            :|..||..:.    ||....|.  :||...: :.||||.||:..|:.|||..|....||....|.
  Fly    58 NDHCSPQHVHQQHVSSDENLPSQPNHDSQRV-KLKRSRTAFTSVQLVELENEFKSNMYLYRTRRI 121

  Fly   207 EMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAP-- 269
            |:|:.|.|.|.||||||||||.|.| |.||.|                 ||..|.  |.:|.|  
  Fly   122 EIAQRLSLCERQVKIWFQNRRMKFK-KDIQGH-----------------REPKSN--AKLAQPQA 166

  Fly   270 --GAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSAS 332
              .|..|:...|::..:...:........|.|.:......|.::..|.:.....:::.:.:|:..
  Fly   167 EQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAVAPVNPKPDYQASQKMKTEASTNNGMCSSADL 231

  Fly   333 SSPVPIPIPGAVRPQRTPCPSPNGQMMSVESGAESVH 369
            |..:.........||.:...|..|...:..|.:.|.|
  Fly   232 SEILEHLAQTTAAPQVSTATSSTGTSTNSASSSSSGH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 28/52 (54%)
zenNP_476793.1 Homeobox 93..146 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.