DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and zen2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:292 Identity:80/292 - (27%)
Similarity:116/292 - (39%) Gaps:68/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 AMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPL 165
            |:.:.|:.     ..|.|.:|.|                |..|.  :.:.::.|..::..||   
  Fly     3 AIQSENYF-----VDNYSVSDLM----------------MYPCV--ELNVEAAPTATTRSSE--- 41

  Fly   166 SHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKT 230
                    :.||||.|||..|:.||||.|...:||:...|.|:::.|.|||.||||||||||.|.
  Fly    42 --------KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKL 98

  Fly   231 KRKQIQQHEAALLGASKRVPVQVLVRED---------GSTTYAHMAAPGAGHGLDPALINIYRHQ 286
            |:.  ...:.|:...:..:|:.....||         ....||:              .|:....
  Fly    99 KKS--TNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYAN--------------TNVETAP 147

  Fly   287 L-QLAYGGLPLPQMQMPF-PYFYPQHKVPQPIPPPTQSSSFVTASSASS----SPVPIPIPGAVR 345
            | |:.:|.|...|:..|: .|.|.....|:|:..|....:...|:.|||    .|. |||...|.
  Fly   148 LRQVDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGLEPT-IPIAENVI 211

  Fly   346 PQRTPCPSPNGQMMSVESGAESVHSA-AEDVD 376
            ...|. ..|..|....:|.:.|..|: ..|||
  Fly   212 EHNTQ-DQPMIQNFCWDSNSSSASSSDILDVD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 30/52 (58%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.