powered by:
Protein Alignment bap and pb
DIOPT Version :9
Sequence 1: | NP_732637.1 |
Gene: | bap / 42537 |
FlyBaseID: | FBgn0004862 |
Length: | 382 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_476669.3 |
Gene: | pb / 40826 |
FlyBaseID: | FBgn0051481 |
Length: | 782 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 34/68 - (50%) |
Similarity: | 46/68 - (67%) |
Gaps: | 2/68 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 SGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQ 234
:||.| |.|.|:::.|:.|||:.|...:||..|.|.|:|.||.|||.|||:||||||.|.||:.
Fly 195 NGLPR--RLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQT 257
Fly 235 IQQ 237
:.:
Fly 258 LSK 260
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D858478at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.