DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and atad3a

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_998849.1 Gene:atad3a / 407895 XenbaseID:XB-GENE-946129 Length:594 Species:Xenopus tropicalis


Alignment Length:105 Identity:26/105 - (24%)
Similarity:46/105 - (43%) Gaps:21/105 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 SPPPLS------SSPSESPLSHDGSGLSR----------KKRSRAAFSHAQVFELERRFAQQRYL 200
            |||..|      :.|.:...:.|.:||.|          .:.::.|.:.|:|.|...:..||..:
 Frog    25 SPPGGSGDGGDKNKPKDKWSNFDPTGLERAAKAARELDQSRHAKEALNLAKVQEETLQLEQQSKI 89

  Fly   201 SGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEA 240
            ...|    |...:|...|:::..:.|| ||..::.:||:|
 Frog    90 KEYE----AAVEQLKNEQIRVQAEERR-KTLNEETKQHQA 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 13/52 (25%)
atad3aNP_998849.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 6/24 (25%)
DUF3523 36..282 CDD:371859 22/94 (23%)
AAA 344..471 CDD:365803
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 571..594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165171362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.