DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and si:dkey-43p13.5

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002661267.2 Gene:si:dkey-43p13.5 / 407678 ZFINID:ZDB-GENE-131121-510 Length:315 Species:Danio rerio


Alignment Length:340 Identity:78/340 - (22%)
Similarity:114/340 - (33%) Gaps:110/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PSSDRERSISKSPPL------CCRDLGLYKLTQPKEIQPSARQPS----------NYLQYYAAAM 102
            |..|...||...|.|      .|.||        :|:...|..|.          |.:.:.|.  
Zfish     8 PLFDWALSIKAKPVLPGLVLMACEDL--------QEVLLPAGSPQCLELFFWSLLNLVMFGAG-- 62

  Fly   103 DNNNHHHQATGTS----NSSAADYMQRKLAYFGSTLAAP----------LDMRRCTSNDSDCDSP 153
                  |..:..|    :|.||.:...    |.|.|::|          .::.|.......|...
Zfish    63 ------HLVSPLSPAVFHSPAAHFFPA----FPSRLSSPQIFIPGPLLSYELLRSYLQPEPCKQS 117

  Fly   154 PPLSSSPSESPLSHDGSGLS-----RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLR 213
            ..|::.||.   .|....:.     :::|:||.:|..|:.|||:.|....|.....|..:|..|.
Zfish   118 LLLAAHPSS---GHPADNIDEPRPVKQRRARANYSSWQLEELEKTFQSTHYPDIFMREALALRLD 179

  Fly   214 LTETQVKIWFQNRRYKTKRK---QIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGL 275
            |.|.:|::||||||.|.:|:   |||..|.    .|:|         |..|.:...:..      
Zfish   180 LIEARVQVWFQNRRAKMRRQLKLQIQTGEQ----CSQR---------DTDTRHPESSIS------ 225

  Fly   276 DPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPI 340
            :|.|.|           ..|.|..........|.|  |:|.|...||                |:
Zfish   226 NPELHN-----------NSPSPCWDRNQDRTNPAH--PKPSPSAIQS----------------PV 261

  Fly   341 PGAVRPQRTP-CPSP 354
            ...::.|:.| .|.|
Zfish   262 TDLLQDQQDPEAPGP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 22/52 (42%)
si:dkey-43p13.5XP_002661267.2 Homeobox 145..197 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.