DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and cdx1a

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_998001.2 Gene:cdx1a / 405762 ZFINID:ZDB-GENE-050510-1 Length:228 Species:Danio rerio


Alignment Length:215 Identity:58/215 - (26%)
Similarity:89/215 - (41%) Gaps:64/215 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DLGLY-------KLTQPK-EIQPSARQPSNYLQYYAAAMDNNNHHHQAT---------------- 112
            |..:|       .|:||. .:.|||..| :|..|:......|:.||..:                
Zfish     8 DTAMYGNPARHLNLSQPHLNVYPSAPYP-DYSGYHPGPALGNDLHHTGSSWSPGFGPGSRDDWPP 71

  Fly   113 ----GTSNSSAADYMQRKL---AYFGSTLAAPLD-------MRRCTSNDSDCDSPPPLSSSPSES 163
                ||.:|..|:.::..:   ...|....||:|       |||              |:.|   
Zfish    72 LYGHGTGHSLPANGVEVSVLPSVDQGLLSGAPVDREEPQDWMRR--------------SAVP--- 119

  Fly   164 PLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRY 228
              ::.|.....|.:.|..:|..|..|||:.|...||::...::|:|.:|.|:|.||||||||||.
Zfish   120 --TNPGGKTRTKDKYRVVYSDVQRLELEKEFHFSRYITIRRKAELAGTLNLSERQVKIWFQNRRA 182

  Fly   229 KTKR------KQIQQHEAAL 242
            |.::      :|:||..:.|
Zfish   183 KERKMNKKRLQQVQQSSSGL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 25/52 (48%)
cdx1aNP_998001.2 Caudal_act 11..115 CDD:282574 22/104 (21%)
COG5576 <122..227 CDD:227863 31/81 (38%)
Homeobox 133..185 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.