DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and PHOX2A

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_005160.2 Gene:PHOX2A / 401 HGNCID:691 Length:284 Species:Homo sapiens


Alignment Length:200 Identity:56/200 - (28%)
Similarity:81/200 - (40%) Gaps:43/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PPPLSSSPSESPLSHDGSGLSRK---KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRL 214
            |.|.|:.|.:  ...:.|||..|   :|.|..|:.||:.||||.||:..|.....|.|:|..:.|
Human    67 PAPYSAVPYK--FFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDL 129

  Fly   215 TETQVKIWFQNRRYKTKRKQIQQHEAALLGA-----SKRVPVQVLVREDGSTTYAHMAAPGAGHG 274
            ||.:|::||||||.|.::   |:..|:..||     :|:...:....:|.|........|.:...
Human   130 TEARVQVWFQNRRAKFRK---QERAASAKGAAGAAGAKKGEARCSSEDDDSKESTCSPTPDSTAS 191

  Fly   275 LDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIP 339
            |.|.                |.|.:..|       ...|.|:|       ....|.....|.|.|
Human   192 LPPP----------------PAPGLASP-------RLSPSPLP-------VALGSGPGPGPGPQP 226

  Fly   340 IPGAV 344
            :.||:
Human   227 LKGAL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 25/52 (48%)
PHOX2ANP_005160.2 Homeobox 94..147 CDD:365835 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..284 22/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.