Sequence 1: | NP_732637.1 | Gene: | bap / 42537 | FlyBaseID: | FBgn0004862 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005160.2 | Gene: | PHOX2A / 401 | HGNCID: | 691 | Length: | 284 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 56/200 - (28%) |
---|---|---|---|
Similarity: | 81/200 - (40%) | Gaps: | 43/200 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 PPPLSSSPSESPLSHDGSGLSRK---KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRL 214
Fly 215 TETQVKIWFQNRRYKTKRKQIQQHEAALLGA-----SKRVPVQVLVREDGSTTYAHMAAPGAGHG 274
Fly 275 LDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIP 339
Fly 340 IPGAV 344 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bap | NP_732637.1 | Homeobox | 178..231 | CDD:278475 | 25/52 (48%) |
PHOX2A | NP_005160.2 | Homeobox | 94..147 | CDD:365835 | 25/52 (48%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 145..284 | 22/119 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |