DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and nkx2-8

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_988951.1 Gene:nkx2-8 / 394548 XenbaseID:XB-GENE-853981 Length:210 Species:Xenopus tropicalis


Alignment Length:253 Identity:82/253 - (32%)
Similarity:110/253 - (43%) Gaps:57/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLA 135
            |.|||      .|...:|.|..:.|.|                ||.:...|::..:..:|     
 Frog    12 RILGL------PEFDSTAIQNDSPLNY----------------TSRTPYQDWLDNERNHF----- 49

  Fly   136 APLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYL 200
                   .:|:||..::..|.::..||.......:...:||:.|..||.||..||||||.|||||
 Frog    50 -------LSSDDSGSETNSPDTTQRSEVGSDSAETEEKKKKKRRVLFSKAQTLELERRFRQQRYL 107

  Fly   201 SGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAH 265
            |.|||.::|..|.||.|||||||||.|||.||  ::...::.....|||.|.|||| ||...   
 Frog   108 SAPERDQLAHILHLTPTQVKIWFQNHRYKMKR--VKPEASSTPPLLKRVMVPVLVR-DGKPC--- 166

  Fly   266 MAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSS 323
            ...|.:.|.        .|..:|:      ||.:...|...||.|   |.:..|:..|
 Frog   167 QTCPSSPHS--------ERESIQV------LPTLHYNFFQGYPHH---QQVAHPSSFS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 36/52 (69%)
nkx2-8NP_988951.1 Homeobox 89..139 CDD:365835 35/49 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450160at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.