DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and exex

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster


Alignment Length:277 Identity:77/277 - (27%)
Similarity:105/277 - (37%) Gaps:78/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGVSAAMAGLSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLC- 69
            :|..:||.|..:.|.....|..:.|.|    .|.....|| |.|:.:..|.....|...|||:. 
  Fly   264 TASNAAAAAQAAASAAGGISEQEALQR----IRDSREYDS-PSPDGMSRSESPTSSHRSSPPISP 323

  Fly    70 -CRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHH---------HQATGTSNSS--AADY 122
             |.|               .:||...|.....:|..::.|         |......:..  |..:
  Fly   324 GCED---------------QQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGH 373

  Fly   123 MQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHD------------GSG---- 171
            ..:.||..||....|||.                |..|...|:.|:            .:|    
  Fly   374 PYQLLAQGGSAFHRPLDP----------------SGKPIPIPMGHNFMPSQLQFEFLARAGMLHH 422

  Fly   172 -------------LSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWF 223
                         |.:.:|.|.||:..|:.|||::|.|.:|||.|:|.|:|..|.|:||||||||
  Fly   423 RIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWF 487

  Fly   224 QNRRYKTKRKQIQQHEA 240
            ||||.|.||.:..|.||
  Fly   488 QNRRMKWKRSKKAQQEA 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 31/52 (60%)
exexNP_648164.1 Homeobox 442..495 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.