DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and pbx3a

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_005171793.1 Gene:pbx3a / 387532 ZFINID:ZDB-GENE-031218-1 Length:457 Species:Danio rerio


Alignment Length:263 Identity:54/263 - (20%)
Similarity:77/263 - (29%) Gaps:101/263 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMA---------------KSLRLTETQVKIWFQN 225
            :|.|..||......|...|  ..:||.|..||.|               |...:|.:||..||.|
Zfish   224 RRKRRNFSKQATEILNEYF--YSHLSNPYPSEEAKEELAKKCAITVSQGKGSTITVSQVSNWFGN 286

  Fly   226 RRYKTKRKQIQQHEAALLGASKR--VPVQVLVREDGSTTYAHMAAPGAG-------HGLDPA--- 278
            :|.:.|:...:..|.|.|.|:|.  ...|.:.....::.....|.|.:|       ..||.|   
Zfish   287 KRIRYKKNIGKFQEEANLYAAKTAVTAAQAVAAAVQNSQNNSPATPSSGFQMKDEEFQLDAAEDK 351

  Fly   279 ---LINIY-----RHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSP 335
               |.|::     .|.|                               |.....|::.||.:.|.
Zfish   352 NNLLNNMFTGTSGSHSL-------------------------------PGSGDLFMSMSSLNGSY 385

  Fly   336 VPIPIPGAVRPQ-------------------RTPCPSPNG--------------QMMSVESGAES 367
            ....:.||.:.|                   ..|..||:|              .:.|...|..|
Zfish   386 QSNQVTGAGQTQGDSIRHAIGQSLGYSDGLRGNPLYSPHGLNGNGVWHDAVTPSSVTSPIEGTNS 450

  Fly   368 VHS 370
            :||
Zfish   451 IHS 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 19/67 (28%)
pbx3aXP_005171793.1 PBC 32..222 CDD:281746
homeodomain 224..294 CDD:238039 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.