DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Dbx

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_647677.2 Gene:Dbx / 38254 FlyBaseID:FBgn0261723 Length:741 Species:Drosophila melanogaster


Alignment Length:375 Identity:82/375 - (21%)
Similarity:125/375 - (33%) Gaps:142/375 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 QPKEIQPSARQPSNYLQYYAAA---------MDNNNHHHQATGTSN-----SSAADYMQRKLAYF 130
            |.:.:|  .:.|.|..|...|:         .|::|:|..:|...|     :|..|....:||..
  Fly   259 QQQHVQ--QQHPGNSCQPQTASSSSSPGSTISDSDNNHGASTANGNGSGTGNSGQDARPHELANS 321

  Fly   131 GSTLAAPLDMRRCTSNDSDCDS--------------------------PPPLSSSPSES------ 163
            .....:... ||.|.:......                          |||:.:.|..|      
  Fly   322 NPDEDSSAS-RRLTQDKQQQQQLLGAGGTGGGGGGGHGHGHPTPPPPPPPPVIAKPMPSRPTPFL 385

  Fly   164 ------------------------------------PLSHDGSGLSRK-KRSRAAFSHAQVFELE 191
                                                |.:|...|..|: ...||.||.:|...||
  Fly   386 PHTLNHPHLHSLLAHCRNPYMSVGAQVFPLPPGQGFPWAHSTRGKPRRGMMRRAVFSDSQRKGLE 450

  Fly   192 RRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASK--------- 247
            :||.||:|:|.|:|.::|:.|.|.::||||||||||.|.:..  ::.|....|.|:         
  Fly   451 KRFQQQKYISKPDRKKLAERLGLKDSQVKIWFQNRRMKWRNS--KERELLASGGSRDQTLPNKNN 513

  Fly   248 -------------RVPVQ-VLVREDGSTTYAHMAAPGAGHGLDPALINI---------YRHQLQL 289
                         ..|:. .|:..:||.|   ...|||....:|....:         .|....:
  Fly   514 PNPDLSDAKCDRPLTPLSPSLLSPNGSAT---PPPPGAVAKDEPPTAAVTPKSPQSVSSRSSPSV 575

  Fly   290 AYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIP 339
            .||      :|:             ..|||..:|..:...|||::|.|:|
  Fly   576 GYG------LQI-------------SSPPPLLTSLKMGDQSASATPTPLP 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 29/52 (56%)
DbxNP_647677.2 Homeobox 437..490 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.