DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and vax1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_919391.2 Gene:vax1 / 373870 ZFINID:ZDB-GENE-030904-9 Length:317 Species:Danio rerio


Alignment Length:344 Identity:76/344 - (22%)
Similarity:115/344 - (33%) Gaps:137/344 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNS 117
            |...|.:.||||:          :...|.:...||            .|::|......::|.   
Zfish    23 KEGKDSQGSISKT----------FLKDQQESFSPS------------GAVENCEKSRASSGD--- 62

  Fly   118 SAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAF 182
              .||.:|.|            :|....:..:...|              .|..|.|.||:|.:|
Zfish    63 --PDYCRRIL------------VRDAKGSIREIILP--------------KGLDLDRPKRTRTSF 99

  Fly   183 SHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHE-------- 239
            :..|::.||..|.:.:|:.|.||:|:|:.|.|:|||||:||||||.|.|:.|.:..|        
Zfish   100 TAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSET 164

  Fly   240 -----------------------------AALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGL 275
                                         ::.||::.|.|...:....||::.:..:|..:|   
Zfish   165 AATCSVLRLLEQGRLLTPPGLPGLLPHCGSSSLGSALRGPSLGITANGGSSSSSSSSAGSSG--- 226

  Fly   276 DPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPV---- 336
                          ..||.|                     |.||.:||........|.|.    
Zfish   227 --------------TAGGSP---------------------PLPTVTSSGTVTGLQGSPPAHGLF 256

  Fly   337 PIPIPG-----AVRPQRTP 350
            ..|:|.     |.|...||
Zfish   257 SFPMPSLLGSVASRISSTP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
vax1NP_919391.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 11/60 (18%)
Homeobox 95..148 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..248 13/82 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.