DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx2-2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001178833.1 Gene:Nkx2-2 / 366214 RGDID:1308443 Length:273 Species:Rattus norvegicus


Alignment Length:312 Identity:103/312 - (33%)
Similarity:135/312 - (43%) Gaps:62/312 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SLT---TPFSINDILTRSNPETR-RMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLT 79
            |||   |.||:.|||  ..|:|. ...||...||.|...|...:     ::.||           
  Rat     2 SLTNTKTGFSVKDIL--DLPDTNDEEGSVAEGPEEENEGPEPAK-----RAGPL----------- 48

  Fly    80 QPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCT 144
                 ..||......|...:...|::::.:    |...::.:.:|..|  .|...:||       
  Rat    49 -----GQSALDAVQSLPLKSPFYDSSDNPY----TRWLASTEGLQYSL--HGLAASAP------- 95

  Fly   145 SNDSDCDSP-PPLSSSPSESPLSHDGSGLSRKKRS-RAAFSHAQVFELERRFAQQRYLSGPERSE 207
            ..||...|| |....||.....:..|.|.:.|||. |..||.||.:||||||.||||||.|||..
  Rat    96 PQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREH 160

  Fly   208 MAKSLRLTETQVKIWFQNRRYKTKRKQIQQ-HEAALLGASKRVPVQVLVREDGSTTYA----HMA 267
            :|..:|||.|||||||||.|||.||.:.:: .|...|.:.:||.|.|||| ||...:|    .:|
  Rat   161 LASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVR-DGKPCHALKAQDLA 224

  Fly   268 APGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPY---FYPQHKVPQPI 316
            |.....|:..:           ||....|..||....|   ..||:....|:
  Rat   225 AATFQAGIPFS-----------AYSAQSLQHMQYNAQYSSASTPQYPTAHPL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 36/53 (68%)
Nkx2-2NP_001178833.1 Homeobox 131..185 CDD:395001 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450160at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.