DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx2-4

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_038962557.1 Gene:Nkx2-4 / 366213 RGDID:1304985 Length:353 Species:Rattus norvegicus


Alignment Length:408 Identity:102/408 - (25%)
Similarity:139/408 - (34%) Gaps:142/408 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQ 80
            ||...|||||::|||:......::...|                  :..:||.....||......
  Rat     3 LSPKHTTPFSVSDILSPIEETYKKFGGV------------------MDGAPPGLGAPLGAAAYRA 49

  Fly    81 PKEIQPSAR-------QPSNYLQYY---------AAAMDNNNHHHQATGTS---NSSAADYMQRK 126
            | ...||::       ||.:.:..:         |||......:|...|.|   :|:...|....
  Rat    50 P-PTGPSSQAAAVAGMQPPHAMAGHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHSAMGSYCNGG 113

  Fly   127 LAYFGSTLAAPLDMR----RCTSNDSDCDSPPPLSS-------------------------SPSE 162
            |...|...|....||    ...:.....::.|..||                         :.|.
  Rat   114 LGNMGELPAYTDGMRGGAAAAATGWYGANTDPRYSSISRFMGPSAGVNVAGMGSLTGIADAAKSL 178

  Fly   163 SPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRR 227
            :||.   :...|:|| |..||.|||:||||||.||:|||.|||..:|..:.||.|||||||||.|
  Rat   179 APLH---AAAPRRKR-RVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHR 239

  Fly   228 YKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYG 292
            ||.||:            :|....|.|.:|.               ||.|               
  Rat   240 YKMKRQ------------AKDKAAQQLQQEG---------------GLGP--------------- 262

  Fly   293 GLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSP------VPIPIPGAVRPQRTPC 351
                                |.|.|||:.....|........|      .|.|..|..:||   .
  Rat   263 --------------------PPPPPPPSPRRVAVPVLVKDGKPCQNGAGTPTPGQGGQQPQ---A 304

  Fly   352 PSPNGQMMSVESGAESVH 369
            |:|..::..:.|...::|
  Rat   305 PTPASELEELSSSPPALH 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 35/52 (67%)
Nkx2-4XP_038962557.1 Homeobox 190..244 CDD:395001 36/54 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.